Hug Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

9,720 results found for hug

lovehug friendshandshakefamilyfriendshappycouple hugsadsmilefamily hug
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"hug"
Footage

Rear view of adult daughter hugging happy senior mother indoors at home.

Medium Shot - Two people hug each other - Slow Motion - shot on RED

Embracing Love: Real Emotions, Positive Atmosphere

Candid Loving Older Couple Hugging. Senior Husband Embracing Wife in front of window

Couple is hugging. Hands of man and woman. Give more hugs.

Close-up of woman giving a warm hug to a man outdoors

Joyful man, car dealership customer hugging his freshly bought car in showroom. Happy gray haired middle aged man with new car at showroom

Young people celebrate birthday with dance and hugs. Emotional moment of togetherness.

Medium Shot - Two men greet and hug each other at a park - shot on RED

Portrait of couple hands, sitting on sofa at home in the living room.

Father lifting child in air over scenic sunset sky. Daddy and daughter playing together, side view, slow motion.

Couple embracing after conflict, showing support and forgiveness in living room

A Joyful Evening on the Beach: Couple Embracing

Silhouette of two businessmen celebrating a success. Slow motion.

Happy couple hugging in the city, slow motion, shot at 60fps

Loving couple sharing affectionate moment while strolling together

Sunset Silhouette of Couple Embracing at Beach

Senior couple hugging in the city during sunset, 120fps

Group of Young People Embrace

Mom and dad hands on pregnant tummy. Pregnant couple caressing pregnant belly. Expectant mother care. Maternity concept. Pregnancy. Happy family. Closeup.

Loving couple embracing outdoors

Couple embracing at home

Family Fun at Sunset: Parents and Child Enjoying Time Together in the Park

Overjoyed ecstatic friendly professional multiracial team business people group bonding celebrating triumph good teamwork result success together standing in office, rewards and achievements concept

Girl hugging a guy, close-up of hands interlocking on the back of a boyfriend

Loving Asian mother and daughter enjoy picnic and storytime in the park. Parenting and family bonding during summer vacation.

Loving couple sharing affectionate moment while strolling together

Emotional girlfriend hugs boyfriend intimately. - Slow Motion - shot on RED

Cool Couple Laughing and hugging In Front Of Beach In autumn

Young man surprises girlfriend with anniversary gift, joyful celebration on violet backdrop

Man and woman hugging. Couple standing indoors. Interesting facts about hugs.

Two joyful friends embracing in a park. Diverse women in vibrant outfits enjoy a laughter-filled gathering.

Father hugs his son on the field at sunset. Slowmo

Medium shot of affectionate elderly Caucasian woman hugging son or grandson and talking to him

Man Twists Partner in His Arms. Close-up.

Couple at the meadow

Two Happy Girlfriends

Three friends embracing each other. Heartwarming bond. Meeting in slow motion.

NEW

Young boy lovingly hugging baby sibling in mother’s arms during a tender family moment on the couch, displaying strong sibling bond and affection, monochrome video.

Portrait Of Two Sisters Sitting On Sofa At Home Smiling Into Camera

Active retired old men and leisure, two senior black brothers talking and hugging in park. Sequence

Reunion of diverse friends in apartment, smiling and talking

Close up of happy senior woman getting gift from friend during celebration outdoors on patio

The couple standing against a starry sky with a northern light. time lapse

Concept of love and friendship. Woman and her border collie dog holding hands and looking at each other. Touching moment of sincerity. Dogs are best friends. Relationship between human and animal.

Two happy women hug each other when meeting after long separation

Family enjoying autumn walk in the park. Slow motion.

Couple Greeting Each Other With Hug As They Meet In Coffee Shop